1,212 Free Images of Make History

historicalnational child labor committee collectionarchivecc-zerolibrarycheckflickrstarpingnewsimages from nationaal archiefdigitallibrary of congress
Family of Mrs. Donovan, 293 1-2 Highland Street, Roxbury, Mass., tying tags for Dennison Co. This is the family that has worked on tags for 7 years and makes an average from that work $30 a LOC cph.3b41011
historicalhistory
Making neckties in the kitchen. The 11 year old girl and 13 year old boy work on the ties every day after school. The... - NARA - 523523
historicalhistory
Making hair-goods in a tiny hall-bedroom. Mrs. Chassin, 385 E. 3rd St., N.Y. top floor. The whole tenement is in a most dilapidated and disreputable state. Hair lying on the bed, trunk and LOC nclc.04200
historicalhistory
Mrs. Streety (a widow) and family. West Point, Miss. The four children on the ground work in the mill. Oldest makes 90 cents a day, - the next, 70 cents, - the boy 30 cents, ('He's slow,' LOC nclc.02125
historicalhistory
Carmela Picciano, 311 E. 149th St., 3(rd) fl(oor) rear. 12 years old. Making Irish lace for collars. Works until 9 P.M. sometimes. Dirty kitchen. LOC nclc.04130
historicalhistory
Brush-making late at night. Photo taken at 9-00 P.M., and they work later. Girls are 12 and 14 years old and go to school working in the morning before school and at night after studying is LOC nclc.04152
historicalhistory
Basso family, making roses in dirty poorly lighted kitchen. Pauline, 6 years old, works after school. Peter, 8, works... - NARA - 523515
historicalhistory
Le Départ, Godissart de Cari, 1814
jean-jacques-régis de cambacérès1810s political cartoons
No Known Restrictions: Martin Luther King Press Conference by Marion S. Trikosko, March 26, 1964 (LOC)
african americanhistory
Papiermachine PM 18 in bedrijf, Bestanddeelnr 930-9824
historicalhistory
Lillian Dambrinio, an eleven-year-old shrimp picker in Peerless Oyster Co. She is an American and lives here. Says picking makes her hands sore. (Not(e) the condition of her shoes. One LOC nclc.00903
historicalhistory
A family making silk flowers. Father wears a cast. Does not work. Boy, 11 years old, helps some. New York City. - NARA - 523516
historicalhistory
Extremes meet. One of the youngest and one of the older messenger boys in Mobile. The small boy is Emmet Brewster, Postal messenger -3. 11 years old; been working there 7 months. Makes $10 LOC nclc.03938
historicalhistory
Family of Mrs. Donovan, 293 1-2 Highland Street, Roxbury, Mass., tying tags for Dennison Co. This is the family that has worked on tags for 7 years and makes an average from that work $30. LOC nclc.04249
historicalhistory
Haskell County, Kansas. Home of large farmer who is making a success of his farming. Perhaps the bes . . . - NARA - 522076
historicalhistory
Papiermachine PM 18 in bedrijf, Bestanddeelnr 930-9822
historicalhistory
Papiermachine PM 18 in bedrijf, Bestanddeelnr 930-9821
historicalhistory
Televisieopname Lets make an opera in Maranti. Nel Burbach en Lidy van der Vee, Bestanddeelnr 913-1008
historicalhistory
How insignificant a newsie is in comparison with matters of State. Peter Pepe, 24 Wonders Court, 10 yr. old newsie, selling on the Capitol steps. Been selling for 2 yrs. Makes 20 cents a LOC nclc.03756
historicalhistory
San Francisco, California. Dave Tatsuno, graduate of University of California in 1936, is making pr . . . - NARA - 537772
historicalhistory
San Francisco, California. Dave Tatsuno, graduate of University of California in 1936, is making pr . . . - NARA - 537771
historicalhistory
Mary Christmas, nearly 4 years old. Picks cranberries sometimes. She is now picking up berries spilled at the barrels by Grandfather. Grandpa says, 'I make her pick sometimes, yes.' LOC cph.3a01108
historicalhistory
Another view of power shovel making roadway on hillside at Norris Dam site. - NARA - 532703
historicalhistory
Los Angeles, California. Lockheed Employment. Making out preliminary application stating name, address, education... - NARA - 532201
californiahistory
Coosa Valley, Alabama. Local family moving off of government reservation to make room for bag loadin . . . - NARA - 522555
historyalabama
Shah Ismail's troops making an assault on an Uzbek fortress, the scaling party led by Bayram Khan, Mu'in Musavvir, Safavid Isfahan, late 17th century
persian miniatures by mu‘in musavvirart from isfahan
No Known Restrictions: Harlem Newsboy by Gordon Parks, 1943 (LOC)
new yorkhistory
No Known Restrictions: Fidel Castro Arrives in Washington, D.C. by Warren K. Leffler, 1959 (LOC)
historywar
Gerlache Strait on the Antarctic Peninsula by David Mobley (NOAA)
landscapehistory
Family of Louis Rizzo, a laborer who works some. The wife and four children (none could speak English at all) work on feathers and make about $3.00 a week. Been in U.S. five months. Do not LOC nclc.05480
historicalhistory
Workers in the Nokomis Cotton Mill, Lexington, N.C. The smallest boy said he was 11 years old and makes 50 cents a day. Been doffing there for some months. The Band Boy who seems much LOC cph.3a47667
historicalhistory
Poston, Arizona. Sewing School. Evacuee students are taught here not only to design but make cloth . . . - NARA - 536645
historicalhistory
3-30 PM Mrs. Rosy Capello, 311 E. 111th St., top floor rear. Makes 50 cents to $1.00 a week on willow plumes. Husband works irregularly as tailor. LOC nclc.04108
historicalhistory
309 W. 146th Street. (...) and her seven year old daughter, Lorenza, embroidering ladies waists in their dirty kitchen-living room. Lorenza makes the stems of the flowers. Her mother said, LOC nclc.05487
historicalhistory
Antoinette Fazzino, ten years old, makes Irish lace for collars and waists, after school. Her younger brother (by the stove) said, 'Lace is too dam-cheap.' Antoinette wears glasses. 303 E. LOC nclc.04131
historicalhistory
Basso family, making roses in dirty poorly lighted kitchen. Pauline, 6 years old, works after school. Peter, 8, works... - NARA - 523515
historicalhistory
School -2, Buffalo, N.Y. Vincent Cannici, 13 years old last summer. Ran apple machine in cannery, Niagara-on-the-Lake, Canada. Lost 9 weeks school in the fall. Did not make good in LOC nclc.00781
historicalhistory
San Antonio newsboys need supervision. Here are three brothers - Sasser family, 729 Porter Street. The youngest one is five years old and makes 30 cents a day. Lawrence is seven years old LOC nclc.03878
historicalhistory
G. Leahy, 1249 Cambridge Street. Messenger for Metropolitan Messenger and Mailing Co., 67 Bromfield Street. Said 14 years old. Gets $5 a week wages, and makes $2.50 a week in tips. Taken at LOC nclc.05605
historicalhistory
Workers in the Nokomis Cotton Mill, Lexington, N.C. The smallest boy said he was 11 years old and makes 50 cents a day. Been doffing there for some months. The Band Boy who seems much LOC cph.3a47666
historicalhistory
F-14A of VF-1 makes barrier landing on USS Kitty Hawk (CV-63) in 1984
historicalhistory
Family of Louis Rizzo, a laborer who works some. The wife and four children (none could speak English at all) work on feathers and make about $3.00 a week. Been in U.S. five months. Do not LOC nclc.05480
historicalhistory
Harry and Sallie. Driver in Maryland Coal Co. Mine, near Sand Lick, Grafton, W. Va. Was afraid to be photo'd because we might make him go to school. Probably 12 years old. LOC cph.3b30369
historicalhistory
Julin, a six-year-old child, making pansies for her neighbors on top floor (Gatto), 106 Thompson Street, N.Y. They said she does this every day, 'but not all day.' A growler and dirty beer LOC cph.3a38582
historicalhistory
Julin, a six-year-old child, making pansies for her neighbors on top floor (Gatto), 106 Thompson Street, N.Y. They said she does this every day, 'but not all day.' A growler and dirty beer LOC cph.3a38582
historicalhistory
Making dresses for Campbell Kid Dolls in a dirty tenement room, 59 Thompson St., N.Y., 4th floor, front-Romana family. The little boys, 5 and 7 years old, help to break the threads, the LOC nclc.04216
historicalhistory
Noon ball game. Boys working at the Priscilla Knitting Mills. Meridian, Miss. Some of the youngest workers are- Kendall Hoffer, 4 Ave. & C St., said was 12 yrs. old and makes $3 to $5 a LOC nclc.02030
historicalhistory
Mrs. Maggie Conte, 428 E. 116th St., top floor makes about $2.00 a week working lace collars, yokes, etc. for Cappellino's factory. Husband is carpenter. Work not steady. Brother-in-law LOC nclc.04120
historicalhistory
309 W. 146th Street. (...) and her seven year old daughter, Lorenza, embroidering ladies waists in their dirty kitchen-living room. Lorenza makes the stems of the flowers. Her mother said, LOC nclc.05487
historicalhistory
Workers in the Nokomis Cotton Mill, Lexington, N.C. The smallest boy said he was 11 years old and makes 50 cents a day. Been doffing there for some months. The Band Boy who seems much LOC nclc.02643
historicalhistory
The employees in Payne Cotton Mill, Macon, Ga. One of the Bibb Mfg. Co. mills. Overseer told me this mill made 70% profit last year and expected to make 100% this year. All these children LOC nclc.01634
historicalhistory
Zuivelfabriek Tnuva. Pakjes boter worden voor verzending in kartonnen dozen verp, Bestanddeelnr 255-4435
historybutter
5 P.M. Making dolls legs for Campbell Kids. Cattena family, 71 Sullivan St., 5(th) floor front. As soon as the photo was taken, Rose carried the box full of finished legs to the Aetna Doll LOC nclc.04143
historicalhistory
Close-up of the scoop of the power shovel making roadway along the river side at Norris Dam site. - NARA - 532700
historicalhistory
Mrs. Abrams, 15 E. 118th St., N.Y. (ground floor). Makes hair-puffs and switches in her parlor. Dresses hair also. The neighbors, in dark inner bed-room, converse as she works. Husband LOC nclc.04196
historicalhistory
Home of Rufine Morini, 6, Coburn Street, South Framingham, Mass. Two mothers, three children - 10, 8 and 6 years old, working on tags for Dennison. Children anaemic. Make $10 (more or less) LOC nclc.05506
historicalhistory
I Would Like to Make Your Acquaintance-Back
historyusa
Malestestra. Get 6 (cents) a gross and make regularly from 10 to 12 gross a day. Mr. Malestestra has been ill for 2... - NARA - 523067
historicalhistory
These garters are made for Berger, 92 Spring St. 9-00 P.M., Feb. 27-12. Making garters (armlets). A Jewish family and neighbors working until late at night. This happens several nights in the week when there is LOC nclc.04202
historicalhistory
Historic American Buildings Survey L. C. Durette, Photographer SOUTH WEST ROOM 2nd. FLOOR CHIMNEY GIRT HAS BEEN CUT BACK TO MAKE LATER PLASTER WALL FLUSH - Doe Garrison, Lamprey HABS NH,8-NEWM,1-37
historicalhistory
10 yr. old news-boy selling during school hours, but he said that he only goes to school in the afternoons. The half-day system makes it very hard to check up truants, but a good many of the LOC nclc.03772
historicalhistory
Los Angeles, California. Caretaker, Mary Ogawa, making preparations to close the Nagamine home prio . . . - NARA - 536784
historicalhistory
Making dresses for Campbell Kid Dolls in a dirty tenement room, 59 Thompson St., N.Y. 4th floor front. Romana family. The older boy, about 12 years old, operates the machine when the mother LOC nclc.05492
historicalhistory
Mrs. Finkelstein, 127 Monroe St. Bessie (age 13), Sophie (age 7). Girls attend school. Making garters for Liberty Garter works, 413 Broadway. Mother , a widow, earns 75 cents a day by LOC nclc.05348
historicalhistory
Some of the Young Boys Working in the Robert Johnson Rand Shoe Factory, Washington, Mo. (Branch of St. Louis firm making Star shoes). On left end is Henry Detmer, who said he has been LOC nclc.04692
historicalhistory
The Ladies' Gallery of the Senate during the Impeachment Trial, William Samuel Lyon Jewett, 18 April 1868
impeachment trial of andrew johnsonharper's weekly, 1868
No Known Restrictions: "Cairo: Citadel and tombs" by Antonio Beato, between 1870-1890 (LOC)
monumenthistory
No Known Restrictions: Portrait of Billie Holiday by Carl Van Vechten, 1949 (LOC)
celebritiesvan
Public Domain: Marine in Da Nang, Vietnam by Unknown Photographer, August 1965 (NARA)
historygun
Jacob van Ruysdael, ca. 1670 Jacob Ruysdaal (titel op object), BI-1997-1407B-37, Willem Steelink, between 1865 and 1870
engravings in the rijksmuseum amsterdamjacob isaacksz. van ruisdael
Giuseppe-gatteri-1668-a-candia-si-rifiuta-la-resa, Giuseppe Lorenzo Gatteri, 2 January 1863
giuseppe lorenzo gatteriromanticism
Florence Valentino, 12 yrs. old, and sister Jennie, working on crochet hats in dirty kitchen tenement, 3126 Jerome Ave. (Bronx). They make heavy hats, muffs, scarfs, slippers, etc. Jennie, LOC nclc.04114
historicalhistory
Family all in mill. Small boy been at it 4 years. Mother said 'she used to make her $1.00 a day spoolin' but she never can now at spinnin'. Some are better at one thing and some at another.' LOC nclc.01371
historicalhistory
Nannie Coleson, looper who said she was 11 years old, and has been working in the Crescent Hosiery Mill for some months. Makes about $3 a week. Has been through the 5th grade in school. She LOC cph.3b19288
historicalhistory
Heart Mountain Relocation Center, Heart Mountain, Wyoming. Cold Wyoming winters make for hard solid . . . - NARA - 539223
historicalhistory
Arthur Kampf Volksopfer 1813, Arthur Kampf
volksopfer by arthur kampf (1813)düsseldorf school of painting
Novembermaand, slachtmaand, grootmoeder en kleindochter maken worst, Bestanddeelnr 906-1173
grandmotherhistory
Mrs. Larocca, 233 E. 107th St., N.Y., making willow plumes in an unlicensed tenement. Photo taken Feb. 29, 1912. License was revoked Dec. 19, 1911.Applied for again Feb 7, 1912, inspected LOC nclc.04203
historicalhistory
Leopoldo Andreoli, 208 Elm St. Very young-appears 11 or 12 years old. Is a 'Loom boy' in spinning room of the Ayer Mill; has a steady job now and makes $5.15 a week now. LOC nclc.02359
historicalhistory
Some of the Young Boys Working in the Robert Johnson Rand Shoe Factory, Washington, Mo. (Branch of St. Louis firm making Star shoes) On left end is Henry Detmer, who said he has been working LOC nclc.04693
historicalhistory
Filipino children make friends with two Naval officers in downtown Manila, hoping for a gift in return. - NARA - 520951
historicalhistory
Interior of tobacco shed, Hawthorn Farm. Girls in foreground are 8, 9, and 10 years old. The 10 yr. old makes 50 cents a day. 12 workers on this farm are 8 to 14 years old, and about 15 are LOC nclc.00735
historicalhistory
Interior of tobacco shed, Hawthorn Farm. Girls in foreground are 8, 9, and 10 years old. The 10 yr. old makes 50 cents a day. 12 workers on this farm are 8 to 14 years old, and about 15 are LOC nclc.00734
historicalhistory
Tipple Boy and Drivers. Maryland Coal Co. Mine, near Sand Lick, Grafton, W. Va. Boy with mule was afraid at first to be in the picture- another boy said he feared we might make him go to LOC cph.3b02436
historicalhistory
Portrait of a young Havasupai girl making a basket, ca.1900 (CHS-4683)
historicalhistory
Photo taken after 9 P.M. Mrs. Barattini, Janitress at 212 Sullivan St., N.Y., and son Louis, 14 years old, and daughter who works in a flower factory all day and helps her mother make these LOC nclc.04140
historicalhistory
Night scene. 7-30 P.M. January 29, 1912. Making violets, and they often work later. Pollinni family, 5 Carmine St., N.Y. living in a reary (i.e., rear.) tenement. The six year old helps LOC nclc.04137
historicalhistory
Interior of tobacco shed, Hawthorn Farm. Girls in foreground are 8, 9, and 10 years old. The 10 yr. old makes 50 cents a -day. 12 workers on this farm are 8 to 14 years old, and about 15 are LOC nclc.00733
historicalhistory
Interior of tobacco shed, Hawthorn Farm. Girls in foreground are 8, 9, and 10 years old. The 10 yr. old makes 50 cents a day. 12 workers on this farm are 8 to 14 years old, and about 15 are LOC nclc.00737
historicalhistory
Interior of tobacco shed, Hawthorn Farm. Girls in foreground are 8, 9, and 10 years old. The 10 yr. old makes 50 cents a day. 12 workers on this farm are 8 to 14 years old, and about 15 are LOC nclc.00736
historicalhistory
Home of Peter Mazkerthlain, 7 Elizabeth St., Worcester, Mass. Children- 6 yrs., 9 yrs., 11 yrs., 12 yrs. old, working on garter buttons. Mother works too. Make $1.50 to $2.00 a week. LOC nclc.04289
historicalhistory
Leopoldo Andreoli, 208 Elm St. Very young-appears 11 or 12 years old. Is a 'Loom boy' in spinning room of the Ayer Mill; has a steady job now and makes $5.15 a week now. LOC nclc.02356
historicalhistory
Nannie Coleson, looper who said she was 11 years old, and has been working in the Crescent Hosiery Mill for some months. Makes about $3 a week. Has been through the 5th grade in school. She LOC cph.3a20272
historicalhistory
A F6F-3 Hellcat from VF-5 makes condensation rings aboard USS Yorktown (CV-10), 20 November 1943 (80-G-204747-A)
historicalhistory
Young workers going home from the Beaumont Mill, Spartenberg (sic), S.C. In the front row are Jesse Farmer, makes 60 cents a day, been working here six months. Haskel Holt, 70 cents a day LOC nclc.02552
historicalhistory
Zaragoza. Real Academia de la Historia (Madrid). Tríptico-relicario del Monasterio de Piedra, en Aragón. Detalles de sus puertas por su haz interior - Teófilo Rufflé
chromolithographsteófilo rufflé
Vrouw bezig met het maken van een strooien hoed in het dorp Lagoen op Curaçao, Bestanddeelnr 252-7484
historicalhistory
03956--1903-Tortillera-Brück & Sohn Kunstverlag
historyvintage
8-00 P.M. January 29, 1912. Cardinale family making silk flowers. Father wears a cast. Does not work. (See report on schedule.) Boy, 11 years old, helps some, even at night. 43 Carmine St., LOC nclc.04138
historicalhistory
Robert Paul, 216 Johnson Street. 10 year old newsy. Found at 11 P.M. with 12 papers near Seminole Hotel. Been at it 4 years. Often sells until midnight. He and brother make about $1.50 a LOC nclc.03852
historicalhistory
801 - 900 of 1,212 Next page
/ 13